PDB entry 1erv

View 1erv on RCSB PDB site
Description: human thioredoxin mutant with cys 73 replaced by ser (reduced form)
Deposited on 1996-02-07, released 1996-10-14
The last revision prior to the SCOP 1.59 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1erv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1erv_ (-)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv