PDB entry 1eru

View 1eru on RCSB PDB site
Description: human thioredoxin (oxidized form)
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-02-07, released 1996-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1erua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eruA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv