PDB entry 1erp

View 1erp on RCSB PDB site
Description: nuclear magnetic resonance solution structure of the pheromone er-10 from the ciliated protozoan euplotes raikovi
Class: pheromone
Keywords: pheromone
Deposited on 1992-12-02, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone er-10
    Species: Euplotes raikovi [TaxId:5938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1erpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1erpA (A:)
    dlceqsalqcneqgchnfcspedkpgclgmvwnpelcp