PDB entry 1ero

View 1ero on RCSB PDB site
Description: x-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-2-phenylacetamido-2-(3-carboxyphenyl)ethyl boronic acid
Class: hydrolase
Keywords: beta-lactamase, structure-based design, boronate inhibitor, HYDROLASE
Deposited on 2000-04-06, released 2000-05-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tem-1 beta-lactamase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62593 (0-262)
  Domains in SCOPe 2.05: d1eroa_
• Heterogens: BJP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eroA (A:)
  hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
  agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
  keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
  qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
  sqatmdernrqiaeigaslikhw