PDB entry 1ern

View 1ern on RCSB PDB site
Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]
Class: cytokine
Keywords: erythropoietin receptor, signal transduction, cytokine receptor class 1
Deposited on 1999-01-11, released 2000-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (erythropoietin receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1erna1, d1erna2
  • Chain 'B':
    Compound: protein (erythropoietin receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ernb1, d1ernb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ernA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ernA (A:)
    kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
    ptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarla
    deghvvlrwlpppetpmtshiryevdvsaggagsvqrveilegrtecvlsnlrgrtrytf
    avrarmaepsfggfwsawsepvslltp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ernB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ernB (B:)
    kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
    ptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarla
    desghvvlrwlpppetpmtshiryevdvsaggagsvqrveilegrtecvlsnlrgrtryt
    favrarmaepsfggfwsawsepvslltps