PDB entry 1ern

View 1ern on RCSB PDB site
Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]
Deposited on 1999-01-11, released 2000-01-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ernA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ernA (A:)
    kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
    ptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarla
    deghvvlrwlpppetpmtshiryevdvsaggagsvqrveilegrtecvlsnlrgrtrytf
    avrarmaepsfggfwsawsepvslltp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ernB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ernB (B:)
    kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
    ptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarla
    desghvvlrwlpppetpmtshiryevdvsaggagsvqrveilegrtecvlsnlrgrtryt
    favrarmaepsfggfwsawsepvslltps