PDB entry 1erm

View 1erm on RCSB PDB site
Description: x-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxyphenyl)ethane boronic acid
Class: hydrolase
Keywords: beta-lactamase, structure-based design, boronate inhibitor, HYDROLASE
Deposited on 2000-04-06, released 2000-05-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tem-1 beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1erma_
  • Heterogens: BJI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ermA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw