PDB entry 1erl

View 1erl on RCSB PDB site
Description: evidence for a cooperative mechanism for cell recognition from the 1.6 angstroms crystal structure of the pheromone er-1 from the ciliated protozoan euplotes raikovi
Deposited on 1994-12-29, released 1995-07-10
The last revision was dated 1995-07-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.199
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1erl_ (-)
    daceqaaiqcvesaceslctegedrtgcymyiysncppyv
    

  • Chain 'p':
    No sequence available.