PDB entry 1erk

View 1erk on RCSB PDB site
Description: structure of signal-regulated kinase
Deposited on 1996-08-06, released 1997-05-15
The last revision prior to the SCOP 1.59 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1erk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1erk_ (-)
    aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqt
    ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
    dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
    lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
    lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
    veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs