PDB entry 1erk

View 1erk on RCSB PDB site
Description: structure of signal-regulated kinase
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, ATP-binding cell cycle, phosphorylation.
Deposited on 1996-08-06, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extracellular regulated kinase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ERK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1erka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1erkA (A:)
    hhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikki
    spfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykll
    ktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadp
    dhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldq
    lnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltf
    nphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp
    gyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1erkA (A:)
    aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqt
    ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
    dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
    lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
    lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
    veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs