PDB entry 1erj

View 1erj on RCSB PDB site
Description: crystal structure of the c-terminal wd40 domain of tup1
Deposited on 2000-04-06, released 2000-07-26
The last revision prior to the SCOP 1.65 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1erja_
  • Chain 'B':
    Domains in SCOP 1.65: d1erjb_
  • Chain 'C':
    Domains in SCOP 1.65: d1erjc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1erjA (A:)
    mdhylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhks
    ldhtsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsaankdpenlntsssp
    ssdlyirsvcfspdgkflatgaedrliriwdienrkivmilqgheqdiysldyfpsgdkl
    vsgsgdrtvriwdlrtgqcsltlsiedgvttvavspgdgkyiaagsldravrvwdsetgf
    lverldsenesgtghkdsvysvvftrdgqsvvsgsldrsvklwnlqnannksdsktpnsg
    tcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkksgnpllmlqghrnsvisvav
    angsslgpeynvfatgsgdckariwkykkiapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1erjA (A:)
    hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
    htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsdssdlyirsvcfspdgkfla
    tgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvsgsgdrtvriwdlrtgqc
    sltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflverldtghkdsvysvvft
    rdgqsvvsgsldrsvklwnltcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkk
    sgnpllmlqghrnsvisvavangsslgpeynvfatgsgdckariwkykki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1erjB (B:)
    mdhylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhks
    ldhtsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsaankdpenlntsssp
    ssdlyirsvcfspdgkflatgaedrliriwdienrkivmilqgheqdiysldyfpsgdkl
    vsgsgdrtvriwdlrtgqcsltlsiedgvttvavspgdgkyiaagsldravrvwdsetgf
    lverldsenesgtghkdsvysvvftrdgqsvvsgsldrsvklwnlqnannksdsktpnsg
    tcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkksgnpllmlqghrnsvisvav
    angsslgpeynvfatgsgdckariwkykkiapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1erjB (B:)
    hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
    htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddlyirsvcfspdgkflatg
    aedrliriwdienrkivmilqgheqdiysldyfpsgdklvsgsgdrtvriwdlrtgqcsl
    tlsiedgvttvavspgdgkyiaagsldravrvwdsetgflverldtghkdsvysvvftrd
    gqsvvsgsldrsvklwnltcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkksg
    npllmlqghrnsvisvavangsslgpeynvfatgsgdckariwkykki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1erjC (C:)
    mdhylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhks
    ldhtsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsaankdpenlntsssp
    ssdlyirsvcfspdgkflatgaedrliriwdienrkivmilqgheqdiysldyfpsgdkl
    vsgsgdrtvriwdlrtgqcsltlsiedgvttvavspgdgkyiaagsldravrvwdsetgf
    lverldsenesgtghkdsvysvvftrdgqsvvsgsldrsvklwnlqnannksdsktpnsg
    tcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkksgnpllmlqghrnsvisvav
    angsslgpeynvfatgsgdckariwkykkiapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1erjC (C:)
    hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
    htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsdlyirsvcfspdgkfla
    tgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvsgsgdrtvriwdlrtgqc
    sltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflverldsenesgtghkdsv
    ysvvftrdgqsvvsgsldrsvklwnlqtcevtyighkdfvlsvattqndeyilsgskdrg
    vlfwdkksgnpllmlqghrnsvisvavangsslgpeynvfatgsgdckariwkykki