PDB entry 1eri

View 1eri on RCSB PDB site
Description: x-ray structure of the DNA-eco ri endonuclease-DNA recognition complex: the recognition network and the integration of recognition and cleavage
Class: hydrolase/DNA
Keywords: protein-DNA complex, double helix, hydrolase/DNA complex
Deposited on 1994-05-18, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.17
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (eco ri endonuclease (e.c.3.1.21.4))
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eria_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*cp*gp*cp*gp*ap*ap*tp*tp*cp*gp*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eriA (A:)
    snkkqsnrlteqhklsqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsi
    kkteinealkkidpdlggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiin
    irngllvgkrgdqdlmaagnaiershkniseianfmlseshfpyvlflegsnfltenisi
    trpdgrvvnleynsgilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqg
    dgrewdskimfeimfdisttslrvlgrdlfeqltsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eriA (A:)
    sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
    lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
    maagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
    ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
    disttslrvlgrdlfeqltsk
    

  • Chain 'B':
    No sequence available.