PDB entry 1erh

View 1erh on RCSB PDB site
Description: three-dimensional solution structure of the extracellular region of the complement regulatory protein, cd59, a new cell surface protein domain related to neurotoxins
Deposited on 1993-12-13, released 1994-04-30
The last revision prior to the SCOP 1.67 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1erh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1erh_ (-)
  lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
  yycckkdlcn