PDB entry 1ere

View 1ere on RCSB PDB site
Description: human estrogen receptor ligand-binding domain in complex with 17beta-estradiol
Deposited on 1997-09-08, released 1998-09-16
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-04, with a file datestamp of 1998-11-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1erea_
  • Chain 'B':
    Domains in SCOP 1.55: d1ereb_
  • Chain 'C':
    Domains in SCOP 1.55: d1erec_
  • Chain 'D':
    Domains in SCOP 1.55: d1ered_
  • Chain 'E':
    Domains in SCOP 1.55: d1eree_
  • Chain 'F':
    Domains in SCOP 1.55: d1eref_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ereA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereA (A:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ereB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereB (B:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ereC (C:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereC (C:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ereD (D:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereD (D:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ereE (E:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereE (E:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ereF (F:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereF (F:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr