PDB entry 1erc

View 1erc on RCSB PDB site
Description: the nmr solution structure of the pheromone er-1 from the ciliated protozoan euplotes raikovi
Class: pheromone
Keywords: pheromone
Deposited on 1994-02-14, released 1994-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone er-1
  Species: Euplotes raikovi [TaxId:5938]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10774 (0-39)
  Domains in SCOPe 2.08: d1erca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ercA (A:)
  daceqaaiqcvesaceslctegedrtgcymyiysncppyv