PDB entry 1erb

View 1erb on RCSB PDB site
Description: the interaction of n-ethyl retinamide with plasma retinol-binding protein (rbp) and the crystal structure of the retinoid-rbp complex at 1.9 angstroms resolution
Class: retinol transport
Keywords: retinol transport
Deposited on 1993-10-01, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1erba_
  • Heterogens: ETR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1erbA (A:)
    erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
    rllnldgtcadsysfvfardpsgfspevqkivrqrqeelclarqyrliphngycdgkser
    nil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1erbA (A:)
    rdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgrv
    rllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqyscr
    llnldgtcadsysfvfardpsgfspevqkivrqrqeelclarqyrliphngycd