PDB entry 1er8

View 1er8 on RCSB PDB site
Description: the active site of aspartic proteinases
Class: hydrolase
Keywords: hydrolase, acid proteinase
Deposited on 1989-10-16, released 1991-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Gene: EAPA, EPN-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1er8e_
  • Chain 'I':
    Compound: h-77
    Database cross-references and differences (RAF-indexed):
    • PDB 1ER8 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1er8E (E:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask
    

  • Chain 'I':
    No sequence available.