PDB entry 1eqz

View 1eqz on RCSB PDB site
Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
Deposited on 2000-04-06, released 2000-04-17
The last revision prior to the SCOP 1.71 freeze date was dated 2000-12-04, with a file datestamp of 2000-12-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1eqza_
  • Chain 'B':
    Domains in SCOP 1.71: d1eqzb_
  • Chain 'C':
    Domains in SCOP 1.71: d1eqzc_
  • Chain 'D':
    Domains in SCOP 1.71: d1eqzd_
  • Chain 'E':
    Domains in SCOP 1.71: d1eqze_
  • Chain 'F':
    Domains in SCOP 1.71: d1eqzf_
  • Chain 'G':
    Domains in SCOP 1.71: d1eqzg_
  • Chain 'H':
    Domains in SCOP 1.71: d1eqzh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqzA (A:)
    msgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkk
    tdshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzA (A:)
    sgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkkt
    dshka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eqzB (B:)
    mpepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzB (B:)
    vtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiagea
    srlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eqzC (C:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzC (C:)
    apatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssa
    vmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eqzD (D:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzD (D:)
    gakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyt
    ehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eqzE (E:)
    msgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkk
    tdshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzE (E:)
    grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae
    ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd
    shkakak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1eqzF (F:)
    mpepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzF (F:)
    tktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageas
    rlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1eqzG (G:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzG (G:)
    prkqlatkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreia
    qdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1eqzH (H:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzH (H:)
    kglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvir
    davtytehakrktvtamdvvyalkrqgrtlygfgg