PDB entry 1eqv

View 1eqv on RCSB PDB site
Description: simplification of a protein loop in staphylococcal nuclease
Class: hydrolase
Keywords: Protein Engineering, Cis peptide, Cis - trans isomerization, HYDROLASE
Deposited on 2000-04-06, released 2003-07-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thermonuclease
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-135)
    • engineered (107-110)
  Domains in SCOPe 2.04: d1eqva_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eqvA (A:)
  klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
  venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaaaaapnntheqhl
  rkseaqakkeklniws