PDB entry 1eqv

View 1eqv on RCSB PDB site
Description: simplification of a protein loop in staphylococcal nuclease
Deposited on 2000-04-06, released 2003-07-08
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1eqva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eqvA (A:)
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaaaaapnntheqhl
rkseaqakkeklniws