PDB entry 1eqv

View 1eqv on RCSB PDB site
Description: simplification of a protein loop in staphylococcal nuclease
Class: hydrolase
Keywords: Protein Engineering, Cis peptide, Cis - trans isomerization, HYDROLASE
Deposited on 2000-04-06, released 2003-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-135)
      • engineered (107-110)
    Domains in SCOPe 2.08: d1eqva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqvA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaaaaapnntheqhl
    rkseaqakkeklniws