PDB entry 1eqt

View 1eqt on RCSB PDB site
Description: met-rantes
Class: cytokine
Keywords: chemoattractant, cytokine, x-ray structure, rantes
Deposited on 2000-04-06, released 2000-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell specific rantes protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (1-67)
      • conflict (1)
      • conflict (18)
    Domains in SCOPe 2.07: d1eqta_
  • Chain 'B':
    Compound: T-cell specific rantes protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (1-67)
      • conflict (1)
      • conflict (18)
    Domains in SCOPe 2.07: d1eqtb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqtA (A:)
    mgyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqtA (A:)
    gyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslems
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eqtB (B:)
    mgyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqtB (B:)
    gyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslems