PDB entry 1eqs

View 1eqs on RCSB PDB site
Description: k38h mutant of streptomyces k15 dd-transpeptidase
Deposited on 2000-04-06, released 2000-05-03
The last revision was dated 2001-06-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.225
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dd-transpeptidase
    Species: Streptomyces sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39042 (0-261)
      • engineered (37)
      • conflict (70-71)
      • conflict (112-113)
      • conflict (155)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1eqsA (A:)
    vtkptiaavggyamnngtgttlytkaadtrrstgstthimtakvvlaqsnlnldakvtiq
    kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks
    figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
    aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
    astsiparesdatkimnygfal