PDB entry 1eqr

View 1eqr on RCSB PDB site
Description: crystal structure of free aspartyl-tRNA synthetase from escherichia coli
Class: ligase
Keywords: Domains, anti-parallel beta strand, beta barrel, oligomer binding fold, LIGASE
Deposited on 2000-04-06, released 2000-06-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eqra1, d1eqra2, d1eqra3
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eqrb1, d1eqrb2, d1eqrb3
  • Chain 'C':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eqrc1, d1eqrc2, d1eqrc3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqrA (A:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvkkaenn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqrB (B:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvkkaenn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqrC (C:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvkkaenn