PDB entry 1eqq

View 1eqq on RCSB PDB site
Description: single stranded DNA binding protein and ssDNA complex
Class: replication/RNA
Keywords: beta barrel, protein-DNA complex, replication/RNA complex
Deposited on 2000-04-06, released 2003-09-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.213
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eqqa_
  • Chain 'B':
    Compound: single stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eqqb_
  • Chain 'C':
    Compound: single stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eqqc_
  • Chain 'D':
    Compound: single stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eqqd_
  • Chain 'M':
    Compound: 5'-r(*(5mu)p*(5mu)p*(5mu))-3'
  • Chain 'N':
    Compound: 5'-r(*(5mu)p*(5mu)p*(5mu))-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqqA (A:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eqqB (B:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eqqC (C:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eqqD (D:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrq
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.