PDB entry 1eqq

View 1eqq on RCSB PDB site
Description: single stranded dna binding protein and ssdna complex
Deposited on 2000-04-06, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-30, with a file datestamp of 2003-09-30.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.213
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1eqqa_
  • Chain 'B':
    Domains in SCOP 1.67: d1eqqb_
  • Chain 'C':
    Domains in SCOP 1.67: d1eqqc_
  • Chain 'D':
    Domains in SCOP 1.67: d1eqqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqqA (A:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eqqB (B:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eqqC (C:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eqqD (D:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggg
    apaggnigggqpqggwgqpqqpqggnqfsggaqsrpqqsapaapsneppmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqqD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrq