PDB entry 1eqp

View 1eqp on RCSB PDB site
Description: exo-b-(1,3)-glucanase from candida albicans
Class: hydrolase
Keywords: candida albicans, exoglucanase, alternative codon usage, hydrolase
Deposited on 2000-04-05, released 2001-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-b-(1,3)-glucanase
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqpA (A:)
    awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaasri
    lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
    nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
    iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
    nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
    vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
    tenapewsfqtltynglfpqpvtdrqfpnqcgfh