PDB entry 1eqo

View 1eqo on RCSB PDB site
Description: crystal structure of a ternary complex of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from e. coli with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.25 angstrom resolution
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, folate, hppk, pterin, 6-hydroxymethyl-7,8-dihydropterin, ternary complex, substrate specificity, antimicrobial agent, drug design, x-ray crystallography
Deposited on 2000-04-05, released 2000-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-08-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.114
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
  Domains in SCOPe 2.08: d1eqoa_
• Heterogens: MG, CL, ACT, APC, HHP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eqoA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw