PDB entry 1eqo

View 1eqo on RCSB PDB site
Description: crystal structure of a ternary complex of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from e. coli with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.25 angstrom resolution
Deposited on 2000-04-05, released 2000-10-25
The last revision was dated 2003-08-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.114
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, ACT, APC, HHP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1eqoA (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw