PDB entry 1eqm

View 1eqm on RCSB PDB site
Description: crystal structure of binary complex of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase with adenosine-5'-diphosphate
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, folate, hppk, pterin, antimicrobial agent, drug design, substrate specificity, x-ray crystallography, transferase
Deposited on 2000-04-05, released 2001-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
  Domains in SCOPe 2.08: d1eqma_
• Heterogens: MG, PO4, ADP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eqmA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw