PDB entry 1eqk

View 1eqk on RCSB PDB site
Description: solution structure of oryzacystatin-I, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica
Class: hydrolase inhibitor
Keywords: alpha and beta proteins, cystatin-like fold, cystatin/monellin superfamily, phytocystatin family, HYDROLASE INHIBITOR
Deposited on 2000-04-05, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oryzacystatin-I
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqkA (A:)
    mssdggpvlggvepvgnendlhlvdlarfavtehnkkansllefeklvsvkqqvvagtly
    yftievkegdakklyeakvwekpwmdfkelqefkpvdasana