PDB entry 1eqk

View 1eqk on RCSB PDB site
Description: solution structure of oryzacystatin-I, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica
Class: hydrolase inhibitor
Keywords: alpha and beta proteins, cystatin-like fold, cystatin/monellin superfamily, phytocystatin family, HYDROLASE INHIBITOR
Deposited on 2000-04-05, released 2001-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: oryzacystatin-I
  Species: Oryza sativa Japonica Group [TaxId:39947]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09229 (0-101)
  Domains in SCOPe 2.08: d1eqka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eqkA (A:)
  mssdggpvlggvepvgnendlhlvdlarfavtehnkkansllefeklvsvkqqvvagtly
  yftievkegdakklyeakvwekpwmdfkelqefkpvdasana