PDB entry 1eqh

View 1eqh on RCSB PDB site
Description: the 2.7 angstrom model of ovine cox-1 complexed with flurbiprofen
Deposited on 2000-04-04, released 2001-04-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqhA (A:)
    vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihfl
    lthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytril
    psvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffkt
    sgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapvl
    mhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqta
    rliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplmp
    dsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdvi
    kesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllekc
    hpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvclnt
    ktcpyvsfhvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqhB (B:)
    vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihfl
    lthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytril
    psvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffkt
    sgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapvl
    mhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqta
    rliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplmp
    dsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdvi
    kesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllekc
    hpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvclnt
    ktcpyvsfhvp