PDB entry 1eqg

View 1eqg on RCSB PDB site
Description: the 2.6 angstrom model of ovine cox-1 complexed with ibuprofen
Class: oxidoreductase
Keywords: EGF DOMAIN, NSAID Binding, Ibuprofen, Membrane-binding Domain, Cyclooxygenase, Peroxidase, Oxidoreductase, Dioxygenase
Deposited on 2000-04-04, released 2001-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prostaglandin h2 synthase-1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqga1, d1eqga2
  • Chain 'B':
    Compound: prostaglandin h2 synthase-1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqgb1, d1eqgb2
  • Heterogens: NAG, BOG, HEM, IBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqgA (A:)
    pvfsadpgapapvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrt
    tlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswe
    sfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaf
    faqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlnge
    vyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaeh
    ptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriame
    fnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrni
    dhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdida
    lefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvk
    tatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqgA (A:)
    vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihfl
    lthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytril
    psvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffkt
    sgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapvl
    mhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqta
    rliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplmp
    dsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdvi
    kesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllekc
    hpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvclnt
    ktcpyvsfhvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eqgB (B:)
    pvfsadpgapapvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrt
    tlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswe
    sfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaf
    faqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlnge
    vyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaeh
    ptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriame
    fnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrni
    dhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdida
    lefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvk
    tatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqgB (B:)
    vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihfl
    lthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytril
    psvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffkt
    sgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapvl
    mhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqta
    rliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplmp
    dsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdvi
    kesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllekc
    hpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvclnt
    ktcpyvsfhvp