PDB entry 1eqf

View 1eqf on RCSB PDB site
Description: crystal structure of the double bromodomain module from human tafii250
Class: transcription
Keywords: Four-Helix Bundle, Acetylated Histone-Tail Binding Protein, TRANSCRIPTION
Deposited on 2000-04-04, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription initiation factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqfa1, d1eqfa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqfA (A:)
    gttvhcdylnrphksihrrrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyy
    kiitrpmdlqtlrenvrkrlypsreefrehlelivknsatyngpkhsltqisqsmldlcd
    eklkekedklarlekainpllddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvp
    dyykvivnpmdletirkniskhkyqsresflddvnlilansvkyngpesqytktaqeivn
    vcyqtlteydehltqlekdictakeaaleeaelesldpmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqfA (A:)
    gttvhcdylnrphksihrrrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyy
    kiitrpmdlqtlrenvrkrlypsreefrehlelivknsatyngpkhsltqisqsmldlcd
    eklkekedklarlekainpllddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvp
    dyykvivnpmdletirkniskhkyqsresflddvnlilansvkyngpesqytktaqeivn
    vcyqtlteydehltqlekdictakeaa