PDB entry 1eqd

View 1eqd on RCSB PDB site
Description: crystal structure of nitrophorin 4 complexed with cn
Class: signaling protein
Keywords: beta barrel, lipocalin fold, ferric heme, cyanide, SIGNALING PROTEIN
Deposited on 2000-04-03, released 2000-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.06: d1eqda_
• Heterogens: CYN, HEV, CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eqdA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk