PDB entry 1eqc

View 1eqc on RCSB PDB site
Description: exo-b-(1,3)-glucanase from candida albicans in complex with castanospermine at 1.85 a
Class: hydrolase
Keywords: exo-glucanase, candida albicans, mechanism-based inhibitors, hydrolase
Deposited on 2000-04-03, released 2000-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-(b)-(1,3)-glucanase
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29717 (0-393)
      • conflict (57)
    Domains in SCOPe 2.07: d1eqca_
  • Heterogens: CTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqcA (A:)
    awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
    lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
    nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
    iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
    nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
    vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
    tenapewsfqtltynglfpqpvtdrqfpnqcgfh