PDB entry 1eqa

View 1eqa on RCSB PDB site
Description: vaccinia methyltransferase vp39 mutant e233q complexed with m7g and s-adenosylhomocysteine
Class: methyltransferase
Keywords: transferase, methylated guanosine, methyltransferase, RNA cap analog, poly(a) polymerase, vaccinia, mRNA processing, transcription, complex (transferase/RNA cap analog)
Deposited on 1999-01-05, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp39
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07617 (0-296)
      • mutation (232)
    Domains in SCOPe 2.07: d1eqaa_
  • Heterogens: SAH, MG7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqaA (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
    pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyqkkmyyln
    kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqaA (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
    dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyqkkmyylnkivrnk
    vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip