PDB entry 1eq9

View 1eq9 on RCSB PDB site
Description: crystal structure of fire ant chymotrypsin complexed to pmsf
Class: hydrolase
Keywords: chymotrypsin, fire ant, serine proteinase, HYDROLASE
Deposited on 2000-04-03, released 2000-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin
    Species: Solenopsis invicta [TaxId:13686]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eq9a_
  • Chain 'B':
    Compound: Chymotrypsin
    Species: Solenopsis invicta [TaxId:13686]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eq9b_
  • Heterogens: PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eq9A (A:)
    ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
    lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
    tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
    plvangaqigivsfgspcalgepdvytrvssfvswinanlkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eq9B (B:)
    ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
    lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
    tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
    plvangaqigivsfgspcalgepdvytrvssfvswinanlkk