PDB entry 1eq3

View 1eq3 on RCSB PDB site
Description: nmr structure of human parvulin hpar14
Class: isomerase
Keywords: peptidyl-prolyl cis-trans isomerase, parvulin
Deposited on 2000-04-02, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl-prolyl cis/trans isomerase (ppiase)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y237 (0-95)
  Domains in SCOPe 2.07: d1eq3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eq3A (A:)
  navkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtrgsmvgpfq
  eaafalpvsgmdkpvftdppvktkfgyhiimvegrk