PDB entry 1eq1

View 1eq1 on RCSB PDB site
Description: nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-III
Class: lipid binding protein
Keywords: Five helix-bundle, "helix-short helix-helix" recognition motif, LIPID BINDING PROTEIN
Deposited on 2000-03-31, released 2002-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipophorin-III
    Species: Manduca sexta [TaxId:7130]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eq1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eq1A (A:)
dapaggnafeemekhakefqktfseqfnslvnskntqdfnkalkdgsdsvlqqlsafsss
lqgaisdangkakealeqarqnvektaeelrkahpdvekeanafkdklqaavqttvqesq
klakevasnmeetnkklapkikqayddfvkhaeevqkklheaatkq