PDB entry 1eq0

View 1eq0 on RCSB PDB site
Description: solution structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with mgamppcp
Class: transferase
Keywords: folate pterin, pyrophosphokinase, pyrophosphoryl transfer, induced conformational change, transferase
Deposited on 2000-03-30, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eq0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eq0A (A:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw