PDB entry 1epy

View 1epy on RCSB PDB site
Description: t4 lysozyme mutant, t21h/c54t/c97a/q141h/t142h
Deposited on 2000-03-29, released 2000-04-12
The last revision prior to the SCOP 1.59 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1epya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1epyA (A:)
    mnifemlrideglrlkiykdhegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynhhpnrakrvittfrtgtwdayk