PDB entry 1epx

View 1epx on RCSB PDB site
Description: crystal structure analysis of aldolase from l. mexicana
Class: lyase
Keywords: beta barrel, pts signal, aldolase, leishmania, fructose-1, 6-bisphosphate, LYASE
Deposited on 2000-03-29, released 2000-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epxa_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epxb_
  • Chain 'C':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epxc_
  • Chain 'D':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1epxA (A:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdddas
    ssslyvkgnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epxA (A:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1epxB (B:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdddas
    ssslyvkgnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epxB (B:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1epxC (C:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdddas
    ssslyvkgnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epxC (C:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1epxD (D:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdddas
    ssslyvkgnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epxD (D:)
    msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
    teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
    lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
    aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
    nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
    lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd