PDB entry 1ept

View 1ept on RCSB PDB site
Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Deposited on 1994-06-07, released 1995-02-07
The last revision prior to the SCOP 1.59 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ept.1
  • Chain 'B':
    Domains in SCOP 1.59: d1ept.1
  • Chain 'C':
    Domains in SCOP 1.59: d1ept.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eptA (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eptB (B:)
    sriqvrlgehnidvlegneqfinaakiithpnfngntldndimliklsspatlnsrvatv
    slprscaaagteclisgwgntk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eptC (C:)
    ssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggpvvcng
    qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan