PDB entry 1ept
View 1ept on RCSB PDB site
Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Class: hydrolase (serine protease)
Keywords: hydrolase (serine protease)
Deposited on
1994-06-07, released
1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: porcine e-trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ept.1 - Chain 'B':
Compound: porcine e-trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ept.1 - Chain 'C':
Compound: porcine e-trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
- Uniprot P00761 (0-97)
- conflict (19)
- conflict (41)
Domains in SCOPe 2.08: d1ept.1 - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1eptA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1eptB (B:)
sriqvrlgehnidvlegneqfinaakiithpnfngntldndimliklsspatlnsrvatv
slprscaaagteclisgwgntk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1eptC (C:)
ssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggpvvcng
qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan