PDB entry 1ept

View 1ept on RCSB PDB site
Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Class: hydrolase (serine protease)
Keywords: hydrolase (serine protease)
Deposited on 1994-06-07, released 1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porcine e-trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ept.1
  • Chain 'B':
    Compound: porcine e-trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ept.1
  • Chain 'C':
    Compound: porcine e-trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-97)
      • conflict (19)
      • conflict (41)
    Domains in SCOPe 2.08: d1ept.1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eptA (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eptB (B:)
    sriqvrlgehnidvlegneqfinaakiithpnfngntldndimliklsspatlnsrvatv
    slprscaaagteclisgwgntk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eptC (C:)
    ssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggpvvcng
    qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan