PDB entry 1eps

View 1eps on RCSB PDB site
Description: structure and topological symmetry of the glyphosphate 5-enol-pyruvylshikimate-3-phosphate synthase: a distinctive protein fold
Class: transferase
Keywords: transferase
Deposited on 1991-04-05, released 1993-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-enol-pyruvyl-3-phosphate synthase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1epsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1epsA (A:)
    mesltlqpiarvdgtinlpgsktvsnralllaalahgktvltnlldsddvrhmlnaltal
    gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
    mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
    plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
    gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
    lnaidmdmnhipdaamtiataalfakgttrlrniynwrvketdrlfamatelrkvgaeve
    eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
    arisqaa