PDB entry 1epm

View 1epm on RCSB PDB site
Description: a structural comparison of 21 inhibitor complexes of the aspartic proteinase from endothia parasitica
Class: hydrolase/hydrolase inhibitor
Keywords: ACID PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1994-07-27, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: endothiapepsin
    Species: Cryphonectria parasitica [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1epme_
  • Chain 'I':
    Compound: ps2, thr-phe-gln-ala-psa-leu-arg-glu
    Database cross-references and differences (RAF-indexed):
    • PDB 1EPM (0-1)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1epmE (E:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask
    

  • Chain 'I':
    No sequence available.