PDB entry 1epg

View 1epg on RCSB PDB site
Description: three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological ph solutions
Class: epidermal growth factor
Keywords: epidermal growth factor
Deposited on 1992-03-24, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: epidermal growth factor
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01132 (0-52)
  Domains in SCOPe 2.08: d1epga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1epgA (A:)
  nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr