PDB entry 1epa

View 1epa on RCSB PDB site
Description: structure of the epididymal retinoic acid-binding protein at 2.1 angstroms resolution
Class: retinoic acid-binding protein
Keywords: retinoic acid-binding protein
Deposited on 1993-06-15, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epididymal retinoic acid-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epaa_
  • Chain 'B':
    Compound: epididymal retinoic acid-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1epaA (A:)
    avvkdfdiskflgfwyeiafaskmgtpglahkeekmgamvvelkenllaltttyysedhc
    vlekvtategdgpakfqvtrlsgkkevvveatdyltyaiiditslvagavhrtmklysrs
    lddngealynfrkitsdhgfsetdlyilkhdltcvkvlqsaaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epaA (A:)
    vkdfdiskflgfwyeiafaskmgtpglahkeekmgamvvelkenllaltttyysedhcvl
    ekvtategdgpakfqvtrlsgkkevvveatdyltyaiiditslvagavhrtmklysrsld
    dngealynfrkitsdhgfsetdlyilkhdltcvkvlqsaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1epaB (B:)
    avvkdfdiskflgfwyeiafaskmgtpglahkeekmgamvvelkenllaltttyysedhc
    vlekvtategdgpakfqvtrlsgkkevvveatdyltyaiiditslvagavhrtmklysrs
    lddngealynfrkitsdhgfsetdlyilkhdltcvkvlqsaaes