PDB entry 1ep9

View 1ep9 on RCSB PDB site
Description: human ornithine transcarbamylase: crystallographic insights into substrate recognition and conformational change
Class: transferase
Keywords: protein-substrate complex, TRANSFERASE
Deposited on 2000-03-28, released 2001-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine transcarbamylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00480 (Start-320)
      • polymorphism (67)
      • polymorphism (236)
    Domains in SCOPe 2.06: d1ep9a1, d1ep9a2
  • Heterogens: CP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ep9A (A:)
    kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt
    rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak
    easipiinglsdlyhpiqiladyltlqehysslkgltlswigdgnnilhsimmsaakfgm
    hlqaatpkgyepdasvtklaeqyakengtkllltndpleaahggnvlitdtwismgreee
    kkkrlqafqgyqvtmktakvaasdwtflhclprkpeevddevfysprslvfpeaenrkwt
    imavmvslltdyspqlqkpkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ep9A (A:)
    vqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrtr
    lstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlake
    asipiinglsdlyhpiqiladyltlqehysslkgltlswigdgnnilhsimmsaakfgmh
    lqaatpkgyepdasvtklaeqyakengtkllltndpleaahggnvlitdtwismgreeek
    kkrlqafqgyqvtmktakvaasdwtflhclprkpeevddevfysprslvfpeaenrkwti
    mavmvslltdyspqlqkpkf