PDB entry 1ep7

View 1ep7 on RCSB PDB site
Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii
Class: electron transport
Keywords: electron transport
Deposited on 2000-03-28, released 2001-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin ch1, h-type
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80028 (0-111)
  Domains in SCOPe 2.08: d1ep7a_
• Chain 'B':
  Compound: thioredoxin ch1, h-type
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80028 (0-111)
  Domains in SCOPe 2.08: d1ep7b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ep7A (A:)
  ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
  kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ep7B (B:)
  ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
  kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa